Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LXN Rabbit Polyclonal Antibody (FITC)

LXN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ECI, TCI

UniProt

Q9BS40

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064554

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCBP1 (NM_006196) Human Over-expression Lysate
LS005093-100ug 100 µg

PCBP1 (NM_006196) Human Over-expression Lysate

Sign In for Pricing
View Details
RIOK2 Antibody
44685-01 50 µL

RIOK2 Antibody

Sign In for Pricing
View Details
RIOK2 Antibody
44685-02 100 µL

RIOK2 Antibody

Sign In for Pricing
View Details
PIK3CG (S1100) (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit gamma Isoform, PtdIns-3-kinase Subunit gamma, PI3K-gamma, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit gamma, PtdIns-3-kinase Subunit p110-gamma, p1
MBS6493472-01 0.1 mL

PIK3CG (S1100) (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit gamma Isoform, PtdIns-3-kinase Subunit gamma, PI3K-gamma, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit gamma, PtdIns-3-kinase Subunit p110-gamma, p1

Sign In for Pricing
View Details
PIK3CG (S1100) (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit gamma Isoform, PtdIns-3-kinase Subunit gamma, PI3K-gamma, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit gamma, PtdIns-3-kinase Subunit p110-gamma, p1
MBS6493472-02 5x 0.1 mL

PIK3CG (S1100) (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit gamma Isoform, PtdIns-3-kinase Subunit gamma, PI3K-gamma, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit gamma, PtdIns-3-kinase Subunit p110-gamma, p1

Sign In for Pricing
View Details
BEGIN antibody
70R-32105 100 ug

BEGIN antibody

Sign In for Pricing
View Details