Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NLRX1 Rabbit Polyclonal Antibody (HRP)

NLRX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NOD5, NOD9, NOD26, DLNB26, CLR11.3

UniProt

Q86UT6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NLRX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

101kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_733840

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (K8.8 + DC10), CF568 conjugate, 0.1mg/mL
BNC680691-500 1x 500 µL

Cytokeratin 8/18 (K8.8 + DC10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ADAM9 Human Gene Knockout Kit (CRISPR)
KN222453BN 1 Kit

ADAM9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tpit (TBX19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G1]
TA800683AM 100 µL

Tpit (TBX19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G1]

Sign In for Pricing
View Details
SMARCA6 (HELLS) Human Gene Knockout Kit (CRISPR)
KN212231BN 1 Kit

SMARCA6 (HELLS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), Biotin conjugate, 0.1mg/mL
BNCB3046-100 1x 100 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTR1A (NM_005736) Human Over-expression Lysate
LY401749 100 µg

ACTR1A (NM_005736) Human Over-expression Lysate

Sign In for Pricing
View Details