Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY14 Rabbit Polyclonal Antibody (FITC)

P2RY14 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P2Y14, BPR105, GPR105

UniProt

Q15391

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LKSSRNSTSVKKKSSRNIFSIVFVFFVCFVPYHIARIPYTKSQTEAHYSC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055694

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyridoxal phosphate Phosphatase PHOSPHO2 (PHOSPHO2) Bovine ELISA Kit
G5891 96 Tests

Pyridoxal phosphate Phosphatase PHOSPHO2 (PHOSPHO2) Bovine ELISA Kit

Sign In for Pricing
View Details
SNORD26 ORF Vector (Human) (pORF)
ORF032965 1.0 µg DNA

SNORD26 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human Ephrin type-A receptor 3 (EPHA3), partial
MBS956024-01 0.02 mg (Mammalian-Cell)

Recombinant Human Ephrin type-A receptor 3 (EPHA3), partial

Sign In for Pricing
View Details
Recombinant Human Ephrin type-A receptor 3 (EPHA3), partial
MBS956024-02 0.02 mg

Recombinant Human Ephrin type-A receptor 3 (EPHA3), partial

Sign In for Pricing
View Details
Recombinant Human Ephrin type-A receptor 3 (EPHA3), partial
MBS956024-03 0.1 mg (Mammalian-Cell)

Recombinant Human Ephrin type-A receptor 3 (EPHA3), partial

Sign In for Pricing
View Details
Recombinant Human Ephrin type-A receptor 3 (EPHA3), partial
MBS956024-04 0.1 mg

Recombinant Human Ephrin type-A receptor 3 (EPHA3), partial

Sign In for Pricing
View Details