Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY14 Rabbit Polyclonal Antibody (HRP)

P2RY14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P2Y14, BPR105, GPR105

UniProt

Q15391

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human P2RY14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055694

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr117 shRNA (m) Lentiviral Particles
sc-150337-V 200 µL

Olfr117 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Human Plasminogen protein (PLG), partial , Active Protein
RPC28896-01 Inquire

Recombinant Human Plasminogen protein (PLG), partial , Active Protein

Sign In for Pricing
View Details
Recombinant Human Plasminogen protein (PLG), partial , Active Protein
RPC28896-02 100 µg

Recombinant Human Plasminogen protein (PLG), partial , Active Protein

Sign In for Pricing
View Details
SQRDL Antibody
GWB-MW657I 50 µg

SQRDL Antibody

Sign In for Pricing
View Details
PHACTR2 Lentiviral Activation Particles (m)
sc-432031-LAC 200 µL

PHACTR2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Complement C5a Protein, Pig, Recombinant (His)
TMPH-03107-01 5 µg

Complement C5a Protein, Pig, Recombinant (His)

Sign In for Pricing
View Details