Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL21 Rabbit Polyclonal Antibody (Biotin)

RPL21 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L21, HYPT12

UniProt

P46778

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF5 antibody - middle region
MBS3200694-01 0.1 mL

IRF5 antibody - middle region

Sign In for Pricing
View Details
IRF5 antibody - middle region
MBS3200694-02 5x 0.1 mL

IRF5 antibody - middle region

Sign In for Pricing
View Details
Ammonium Metavanadate 99% AR
00218 00500 500 g

Ammonium Metavanadate 99% AR

Sign In for Pricing
View Details
NANP Double Nickase Plasmid (m)
sc-426497-NIC 20 µg

NANP Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Lymphotoxin beta Receptor (LTBR, CD18, TNFCR, TNFR3, D12S370, TNFR-RP, TNFRSF3, Tumor Necrosis Factor C Receptor, Tumor Necrosis Factor Receptor Superfamily Member 3, TNFR2-RP, LT-BETA-R, TNF-R-III) (MaxLight 650)
MBS6425052-01 0.1 mL

Lymphotoxin beta Receptor (LTBR, CD18, TNFCR, TNFR3, D12S370, TNFR-RP, TNFRSF3, Tumor Necrosis Factor C Receptor, Tumor Necrosis Factor Receptor Superfamily Member 3, TNFR2-RP, LT-BETA-R, TNF-R-III) (MaxLight 650)

Sign In for Pricing
View Details
Lymphotoxin beta Receptor (LTBR, CD18, TNFCR, TNFR3, D12S370, TNFR-RP, TNFRSF3, Tumor Necrosis Factor C Receptor, Tumor Necrosis Factor Receptor Superfamily Member 3, TNFR2-RP, LT-BETA-R, TNF-R-III) (MaxLight 650)
MBS6425052-02 5x 0.1 mL

Lymphotoxin beta Receptor (LTBR, CD18, TNFCR, TNFR3, D12S370, TNFR-RP, TNFRSF3, Tumor Necrosis Factor C Receptor, Tumor Necrosis Factor Receptor Superfamily Member 3, TNFR2-RP, LT-BETA-R, TNF-R-III) (MaxLight 650)

Sign In for Pricing
View Details