Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL21 Rabbit Polyclonal Antibody (FITC)

RPL21 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L21, HYPT12

UniProt

P46778

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human METTL8 activation kit by CRISPRa
GA112657 1 Kit

Human METTL8 activation kit by CRISPRa

Sign In for Pricing
View Details
Thymine DNA glycosylase (TDG) (C-term) Rabbit Polyclonal Antibody
AP17780PU-N 400 µL

Thymine DNA glycosylase (TDG) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Biotin Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103B-01 25 µg

Biotin Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Biotin Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103B-02 100 µg

Biotin Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Frozen Tissue Sections, Metastasis, unknown source
CS500470 5x 5 µm

Frozen Tissue Sections, Metastasis, unknown source

Sign In for Pricing
View Details
Amer1 Mouse Gene Knockout Kit (CRISPR)
KN501187 1 Kit

Amer1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details