Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL21 Rabbit Polyclonal Antibody (HRP)

RPL21 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L21, HYPT12

UniProt

P46778

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ifnb1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6899903 1.0 µg DNA

Ifnb1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human RNASE8 siRNA
abx931629-01 15 nmol

Human RNASE8 siRNA

Sign In for Pricing
View Details
Human RNASE8 siRNA
abx931629-02 30 nmol

Human RNASE8 siRNA

Sign In for Pricing
View Details
Lentiviral human RAI2 shRNA (UAS) - Lentiviral human RAI2 shRNA (UAS, GFP) (100)
GTR15134313 1 Vial

Lentiviral human RAI2 shRNA (UAS) - Lentiviral human RAI2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
SART-1 Lentiviral Activation Particles (h)
sc-404297-LAC 200 µL

SART-1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Human TWEAK Protein (Highly Pure)
B2010373 10 µg

Human TWEAK Protein (Highly Pure)

Sign In for Pricing
View Details