Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRCC3 Rabbit Polyclonal Antibody (Biotin)

BRCC3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C6.1A, BRCC36, CXorf53

UniProt

P46736

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human BRCC3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001018065.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human KNTC1 shRNA (UAS) - Lentiviral human KNTC1 shRNA (UAS, GFP) (100)
GTR15334992 1 Vial

Lentiviral human KNTC1 shRNA (UAS) - Lentiviral human KNTC1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
IFN beta GFP reporter lentivirus (Hyg) - IFN beta GFP reporter lentivirus (Hyg)
GTR15424400 25 µL (1x 25 µL)

IFN beta GFP reporter lentivirus (Hyg) - IFN beta GFP reporter lentivirus (Hyg)

Sign In for Pricing
View Details
Recombinant Herminiimonas arsenicoxydans UPF0758 protein HEAR2468 (HEAR2468)
MBS1154622-01 0.02 mg (E-Coli)

Recombinant Herminiimonas arsenicoxydans UPF0758 protein HEAR2468 (HEAR2468)

Sign In for Pricing
View Details
Recombinant Herminiimonas arsenicoxydans UPF0758 protein HEAR2468 (HEAR2468)
MBS1154622-02 0.1 mg (E-Coli)

Recombinant Herminiimonas arsenicoxydans UPF0758 protein HEAR2468 (HEAR2468)

Sign In for Pricing
View Details
Recombinant Herminiimonas arsenicoxydans UPF0758 protein HEAR2468 (HEAR2468)
MBS1154622-03 0.02 mg (Yeast)

Recombinant Herminiimonas arsenicoxydans UPF0758 protein HEAR2468 (HEAR2468)

Sign In for Pricing
View Details
Recombinant Herminiimonas arsenicoxydans UPF0758 protein HEAR2468 (HEAR2468)
MBS1154622-04 0.1 mg (Yeast)

Recombinant Herminiimonas arsenicoxydans UPF0758 protein HEAR2468 (HEAR2468)

Sign In for Pricing
View Details