Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRCC3 Rabbit Polyclonal Antibody (FITC)

BRCC3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C6.1A, BRCC36, CXorf53

UniProt

P46736

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human BRCC3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001018065.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ESAM (NM_138961) Human Recombinant Protein
TP720297XL 1 mg

ESAM (NM_138961) Human Recombinant Protein

Sign In for Pricing
View Details
CEP19 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV656733 1.0 µg DNA

CEP19 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Netrin 1 (NTN1) chicken polyclonal antibody
CH23002-100 100 µL

Netrin 1 (NTN1) chicken polyclonal antibody

Sign In for Pricing
View Details
MFluor™ Green 620 Anti-human CD11a Antibody *R7-1*
101140U0-AAT 100 Tests

MFluor™ Green 620 Anti-human CD11a Antibody *R7-1*

Sign In for Pricing
View Details
Postsynaptic Density Protein 95 (PSD-95, PSD95, Discs Large Homolog 4, DLG4, Post-synaptic Density Protein 95, Synapse-associated Protein 90, SAP90, SAP-90)
MBS601914-01 0.025 mg

Postsynaptic Density Protein 95 (PSD-95, PSD95, Discs Large Homolog 4, DLG4, Post-synaptic Density Protein 95, Synapse-associated Protein 90, SAP90, SAP-90)

Sign In for Pricing
View Details
Postsynaptic Density Protein 95 (PSD-95, PSD95, Discs Large Homolog 4, DLG4, Post-synaptic Density Protein 95, Synapse-associated Protein 90, SAP90, SAP-90)
MBS601914-02 0.1 mg

Postsynaptic Density Protein 95 (PSD-95, PSD95, Discs Large Homolog 4, DLG4, Post-synaptic Density Protein 95, Synapse-associated Protein 90, SAP90, SAP-90)

Sign In for Pricing
View Details