Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS1R2 Rabbit Polyclonal Antibody (HRP)

TAS1R2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TR2, T1R2, GPR71

UniProt

Q8TE23

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAS1R2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_689418

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC4 Peptide - N-terminal region
orb2000833 100 µg

HDAC4 Peptide - N-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal CD97 Isoform 1 Antibody (380903) [DyLight 680]
FAB2529Y 0.1 mL

Mouse Monoclonal CD97 Isoform 1 Antibody (380903) [DyLight 680]

Sign In for Pricing
View Details
(C10-C16) Alkyl benzene sulfonic acid
FA158286-01 1 Kg

(C10-C16) Alkyl benzene sulfonic acid

Sign In for Pricing
View Details
(C10-C16) Alkyl benzene sulfonic acid
FA158286-02 2 Kg

(C10-C16) Alkyl benzene sulfonic acid

Sign In for Pricing
View Details
(C10-C16) Alkyl benzene sulfonic acid
FA158286-03 5 Kg

(C10-C16) Alkyl benzene sulfonic acid

Sign In for Pricing
View Details
Helios (D8W4X) XP® Rabbit Monoclonal Antibody (mFluor™ Red 780 Conjugate)
CST 72658S 100 µL

Helios (D8W4X) XP® Rabbit Monoclonal Antibody (mFluor™ Red 780 Conjugate)

Sign In for Pricing
View Details