Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APLF Rabbit Polyclonal Antibody (HRP)

APLF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

APFL, PALF, Xip1, ZCCHH1, C2orf13

UniProt

Q8IW19

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human APLF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NVLDEDNDNVGQPNEYDLNDSFLDDEEEDYEPTDEDSDWEPGKEDEEKED

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775816

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CHGA, N-His
MBS1573267-01 0.1 mg

Recombinant Human CHGA, N-His

Sign In for Pricing
View Details
Recombinant Human CHGA, N-His
MBS1573267-02 1 mg

Recombinant Human CHGA, N-His

Sign In for Pricing
View Details
Recombinant Human CHGA, N-His
MBS1573267-03 5x 1 mg

Recombinant Human CHGA, N-His

Sign In for Pricing
View Details
PNLDC1 Rabbit Polyclonal Antibody
orb630043-01 50 µg

PNLDC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PNLDC1 Rabbit Polyclonal Antibody
orb630043-02 100 µg

PNLDC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant AMACR Antibody / p504S
orb639955-01 20 µg

Recombinant AMACR Antibody / p504S

Sign In for Pricing
View Details