Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX7C Rabbit Polyclonal Antibody (HRP)

COX7C Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P15954

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

5kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001858

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human Parathyroid hormone polyclonal Antibody, FITC
MBS1496913-01 0.05 mg

Rabbit anti-human Parathyroid hormone polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Parathyroid hormone polyclonal Antibody, FITC
MBS1496913-02 0.1 mg

Rabbit anti-human Parathyroid hormone polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Parathyroid hormone polyclonal Antibody, FITC
MBS1496913-03 5x 0.1 mg

Rabbit anti-human Parathyroid hormone polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rat Kansl1 Pre-designed siRNA Set A
SI207015A 1 Each

Rat Kansl1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-V5 Tag (E10 / V4RR) Monoclonal Antibody
ABP-MAB-VT004 100 ug

Anti-V5 Tag (E10 / V4RR) Monoclonal Antibody

Sign In for Pricing
View Details
Monkey Retinoic acid receptor alpha (RARA) ELISA Kit
MBS7235552-01 48 Well

Monkey Retinoic acid receptor alpha (RARA) ELISA Kit

Sign In for Pricing
View Details