Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX7C Rabbit Polyclonal Antibody (HRP)

COX7C Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P15954

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

5kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001858

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XFD350 Anti-human/monkey CD20 Antibody *2H7*
10202130-AAT 100 Tests

XFD350 Anti-human/monkey CD20 Antibody *2H7*

Sign In for Pricing
View Details
Fndc7 3'UTR Luciferase Stable Cell Line
TU204716 1.0 mL

Fndc7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Monkey EGF Antibody Pair Set
E-KAB-0664 50 µL & 100 µg

Monkey EGF Antibody Pair Set

Sign In for Pricing
View Details
Rat Bombesin ELISA Kit
MBS7269459-01 48 Well

Rat Bombesin ELISA Kit

Sign In for Pricing
View Details
Rat Bombesin ELISA Kit
MBS7269459-02 96 Well

Rat Bombesin ELISA Kit

Sign In for Pricing
View Details
Rat Bombesin ELISA Kit
MBS7269459-03 5x 96 Well

Rat Bombesin ELISA Kit

Sign In for Pricing
View Details