Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3J Rabbit Polyclonal Antibody (Biotin)

EIF3J Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EIF3S1, eIF3-p35, eIF3-alpha

UniProt

O75822

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003749

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPCB, ID (Heat Shock 84kD, HSP 84, Heat Shock Protein HSP 90-beta, HSP 90, HSP90AB1, HSP90B, HSPC2, HSP84) (HRP) discontinued
H1832-98G-HRP 200 µL

HSPCB, ID (Heat Shock 84kD, HSP 84, Heat Shock Protein HSP 90-beta, HSP 90, HSP90AB1, HSP90B, HSPC2, HSP84) (HRP) discontinued

Sign In for Pricing
View Details
FRA1 Peptide
orb1234106 0.1 mg

FRA1 Peptide

Sign In for Pricing
View Details
Rabbit Cathepsin S ELISA Kit
MBS721067-01 48 Well

Rabbit Cathepsin S ELISA Kit

Sign In for Pricing
View Details
Rabbit Cathepsin S ELISA Kit
MBS721067-02 96 Well

Rabbit Cathepsin S ELISA Kit

Sign In for Pricing
View Details
Rabbit Cathepsin S ELISA Kit
MBS721067-03 5x 96 Well

Rabbit Cathepsin S ELISA Kit

Sign In for Pricing
View Details
Rabbit Cathepsin S ELISA Kit
MBS721067-04 10x 96 Well

Rabbit Cathepsin S ELISA Kit

Sign In for Pricing
View Details