Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3J Rabbit Polyclonal Antibody (FITC)

EIF3J Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EIF3S1, eIF3-p35, eIF3-alpha

UniProt

O75822

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003749

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPPL3 siRNA (m)
sc-153781 10 µM

SPPL3 siRNA (m)

Sign In for Pricing
View Details
Lentiviral mouse Stk11 shRNA (UAS) - Lentiviral mouse Stk11 shRNA (UAS, GFP) plasmid
GTR15138382 1 Vial

Lentiviral mouse Stk11 shRNA (UAS) - Lentiviral mouse Stk11 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Keratin 6C (KRT6C)
MBS2072763-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Keratin 6C (KRT6C)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Keratin 6C (KRT6C)
MBS2072763-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Keratin 6C (KRT6C)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Keratin 6C (KRT6C)
MBS2072763-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Keratin 6C (KRT6C)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Keratin 6C (KRT6C)
MBS2072763-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Keratin 6C (KRT6C)

Sign In for Pricing
View Details