Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNA14 Rabbit Polyclonal Antibody (Biotin)

GNA14 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

O95837

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004288

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guanidinoacetic Acid
TRC-G821250-25G 25 g

Guanidinoacetic Acid

Sign In for Pricing
View Details
Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit
MBS8805829-01 48 Well

Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit
MBS8805829-02 96 Well

Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit
MBS8805829-03 5x 96 Well

Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit
MBS8805829-04 10x 96 Well

Rat NPR1 (Natriuretic Peptide Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Homovanillic Acid (HVA) ELISA Kit
E1220 96 Tests

Homovanillic Acid (HVA) ELISA Kit

Sign In for Pricing
View Details