Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LANCL1 Rabbit Polyclonal Antibody (Biotin)

LANCL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P40, GPR69A

UniProt

O43813

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006046

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Sema3b shRNA (UAS) - Lentiviral mouseSema3b shRNA (UAS, GFP) (25)
GTR15239240 1 Vial

Lentiviral mouse Sema3b shRNA (UAS) - Lentiviral mouseSema3b shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
CD107a antibody (FITC)
61R-CD107AAHUFT 100 Piece

CD107a antibody (FITC)

Sign In for Pricing
View Details
CSTA, CT (CSTA, STF1, STFA, Cystatin-A, Cystatin-AS, Stefin-A) (MaxLight 405)
MBS6289511-01 0.1 mL

CSTA, CT (CSTA, STF1, STFA, Cystatin-A, Cystatin-AS, Stefin-A) (MaxLight 405)

Sign In for Pricing
View Details
CSTA, CT (CSTA, STF1, STFA, Cystatin-A, Cystatin-AS, Stefin-A) (MaxLight 405)
MBS6289511-02 5x 0.1 mL

CSTA, CT (CSTA, STF1, STFA, Cystatin-A, Cystatin-AS, Stefin-A) (MaxLight 405)

Sign In for Pricing
View Details
SLC39A4 Blocking Peptide
33R-9661 0.1 mg

SLC39A4 Blocking Peptide

Sign In for Pricing
View Details
Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 4 (LGR4), partial
orb2986128-01 20 µg

Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 4 (LGR4), partial

Sign In for Pricing
View Details