Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA3 Rabbit Polyclonal Antibody (FITC)

LILRA3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HM31, HM43, ILT6, LIR4, CD85E, ILT-6, LIR-4

UniProt

Q8N6C8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LILRA3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_006856

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase Conjugated Vigna radiata Lectin (Mung Bean) -VRA-
LA-6501-1 1 mg

Alkaline Phosphatase Conjugated Vigna radiata Lectin (Mung Bean) -VRA-

Sign In for Pricing
View Details
CD20 (MS4A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C11]
TA800534BM 100 µL

CD20 (MS4A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C11]

Sign In for Pricing
View Details
DLL1 (NM_005618) Human Over-expression Lysate
LY401722 100 µg

DLL1 (NM_005618) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin, pan (AE-1 / AE-3), CF647 conjugate, 0.1mg/mL
BNC470371-500 1x 500 µL

Cytokeratin, pan (AE-1 / AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI5H3]
CF807110 100 µg

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI5H3]

Sign In for Pricing
View Details
Vmn2r54 Mouse Gene Knockout Kit (CRISPR)
KN519184 1 Kit

Vmn2r54 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details