Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA3 Rabbit Polyclonal Antibody (Biotin)

LILRA3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HM31, HM43, ILT6, LIR4, CD85E, ILT-6, LIR-4

UniProt

Q8N6C8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHP

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_006856

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRH2 Polyclonal Antibody, HRP Conjugated
bs-7672R-HRP 100 µL

NRH2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Human Mediator of RNA polymerase II transcription subunit 15 (MED15) ELISA Kit
GTR10337072 96 Well

Human Mediator of RNA polymerase II transcription subunit 15 (MED15) ELISA Kit

Sign In for Pricing
View Details
UBE3C Protein Vector (Human) (pPB-C-His)
PV045041 500 ng

UBE3C Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CD44 Antibody / HCAM
V8829-20UG 20 µg

CD44 Antibody / HCAM

Sign In for Pricing
View Details
LRP5L Rabbit pAb, IRDye 800CW conjugated
orb2844807 100 µL

LRP5L Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
PKNOX1 (PBX/Knotted 1 Homeobox 1, Homeobox Protein PKNOX1, Human Homeobox Containing Protein, Pbx Regulating Protein 1, PREP1) (MaxLight 750) discontinued
131405-ML750 100 µL

PKNOX1 (PBX/Knotted 1 Homeobox 1, Homeobox Protein PKNOX1, Human Homeobox Containing Protein, Pbx Regulating Protein 1, PREP1) (MaxLight 750) discontinued

Sign In for Pricing
View Details