Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MATN4 Rabbit Polyclonal Antibody (Biotin)

MATN4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ14417, HE6WCR54

UniProt

A6NNA4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LRGLNVGPNATRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_085095

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCAPH2 (NM_001185011) Human Tagged ORF Clone Lentiviral Particle
RC230339L4V 200 µL

NCAPH2 (NM_001185011) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Pro Caspase 3 Rabbit mAb
58554 50 µL

Pro Caspase 3 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 042R (IIV6-042R)
MBS1375151-01 0.02 mg (E-Coli)

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 042R (IIV6-042R)

Sign In for Pricing
View Details
Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 042R (IIV6-042R)
MBS1375151-02 0.1 mg (E-Coli)

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 042R (IIV6-042R)

Sign In for Pricing
View Details
Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 042R (IIV6-042R)
MBS1375151-03 0.02 mg (Yeast)

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 042R (IIV6-042R)

Sign In for Pricing
View Details
Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 042R (IIV6-042R)
MBS1375151-04 0.1 mg (Yeast)

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 042R (IIV6-042R)

Sign In for Pricing
View Details