Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MATN4 Rabbit Polyclonal Antibody (HRP)

MATN4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ14417, HE6WCR54

UniProt

A6NNA4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRGLNVGPNATRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_085095

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDF4 Rabbit Polyclonal Antibody (BF488)
orb2398204 100 µL

SDF4 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Porcine Soluble Adhesion Molecules ELISA Kit
MBS041746-01 48 Well

Porcine Soluble Adhesion Molecules ELISA Kit

Sign In for Pricing
View Details
Porcine Soluble Adhesion Molecules ELISA Kit
MBS041746-02 96 Well

Porcine Soluble Adhesion Molecules ELISA Kit

Sign In for Pricing
View Details
Porcine Soluble Adhesion Molecules ELISA Kit
MBS041746-03 5x 96 Well

Porcine Soluble Adhesion Molecules ELISA Kit

Sign In for Pricing
View Details
Porcine Soluble Adhesion Molecules ELISA Kit
MBS041746-04 10x 96 Well

Porcine Soluble Adhesion Molecules ELISA Kit

Sign In for Pricing
View Details
Human Gonadotropin Releasing Hormone (GnRH) ELISA Kit
BSKH61046-01 48 Tests

Human Gonadotropin Releasing Hormone (GnRH) ELISA Kit

Sign In for Pricing
View Details