Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP21 Rabbit Polyclonal Antibody (FITC)

MMP21 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HTX7, MMP-21

UniProt

Q8N119

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse MMP21

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GEVRVR' target='_blank'>YIPQEPAFELDWADRKAIQRLYGSCKGSFDTVFDWIRKERNQYGEVRVR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_671724.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNK1/2/3 Rabbit Polyclonal Antibody
E28PT2440 100 µL

JNK1/2/3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-DNA Ligase III/LIG3 Antibody Picoband®, HRP Conjugate
A02741-2-HRP 100 µg/Vial

Anti-DNA Ligase III/LIG3 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Lentiviral human SUPT7L sgRNA gene knockout kit - Lentiviral human SUPT7L sgRNA gene knockout kit (100)
GTR15357421 1 Vial

Lentiviral human SUPT7L sgRNA gene knockout kit - Lentiviral human SUPT7L sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
TLK1 Protein Vector (Rat) (pPB-N-His)
PV310987 500 ng

TLK1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Anti ACSBG1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8422173-01 0.001 mL

Rabbit Anti ACSBG1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti ACSBG1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8422173-02 5x 0.001 mL

Rabbit Anti ACSBG1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details