Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDRG3 Rabbit Polyclonal Antibody (HRP)

NDRG3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ13556

UniProt

Q9UGV2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NDRG3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLARSRTHSTSSSLGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTME

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_071922

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vav2 (Tyr-142)[conserved site], phospho-specific Antibody
MBS474643-01 0.1 mL

Vav2 (Tyr-142)[conserved site], phospho-specific Antibody

Sign In for Pricing
View Details
Vav2 (Tyr-142)[conserved site], phospho-specific Antibody
MBS474643-02 5x 0.1 mL

Vav2 (Tyr-142)[conserved site], phospho-specific Antibody

Sign In for Pricing
View Details
14-3-3 beta (Tyrosine 3-monooxygenase/tryptopan 5-monooxygenase Activation Protein beta Polypeptide, YWHAB) discontinued
135869 50 µL

14-3-3 beta (Tyrosine 3-monooxygenase/tryptopan 5-monooxygenase Activation Protein beta Polypeptide, YWHAB) discontinued

Sign In for Pricing
View Details
Guinea pig LDL immune complexes (LDL-IC) ELISA Kit
MBS268931-01 48 Well

Guinea pig LDL immune complexes (LDL-IC) ELISA Kit

Sign In for Pricing
View Details
Guinea pig LDL immune complexes (LDL-IC) ELISA Kit
MBS268931-02 96 Well

Guinea pig LDL immune complexes (LDL-IC) ELISA Kit

Sign In for Pricing
View Details
Guinea pig LDL immune complexes (LDL-IC) ELISA Kit
MBS268931-03 5x 96 Well

Guinea pig LDL immune complexes (LDL-IC) ELISA Kit

Sign In for Pricing
View Details