Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHOSPHO1 Rabbit Polyclonal Antibody (Biotin)

PHOSPHO1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8TCT1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001137276

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL15P6 3'UTR GFP Stable Cell Line
TU070789 1.0 mL

RPL15P6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human IVD qPCR Primer Pair
QH16829S 200 Tests

Human IVD qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral human SMIM10 sgRNA gene knockout kit - Lentiviral human SMIM10 sgRNA gene knockout kit (25)
GTR15357729 1 Vial

Lentiviral human SMIM10 sgRNA gene knockout kit - Lentiviral human SMIM10 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Lentiviral human FABP7 shRNA (UAS) - Lentiviral human FABP7 shRNA (UAS, RFP) (25)
GTR15132875 1 Vial

Lentiviral human FABP7 shRNA (UAS) - Lentiviral human FABP7 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Celiprolol hydrochloride
S5923-2mg 2 mg

Celiprolol hydrochloride

Sign In for Pricing
View Details
Lentiviral mouse Virma shRNA (UAS) - Lentiviral mouse Virma shRNA (UAS, GFP) (100)
GTR15175137 1 Vial

Lentiviral mouse Virma shRNA (UAS) - Lentiviral mouse Virma shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details