Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX27 Rabbit Polyclonal Antibody (Biotin)

SNX27 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MRT1, MY014

UniProt

Q96L92

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SNX27

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(E)-4,5-Dihydroxypent-2-enoic Acid Sodium Salt
TRC-D801390-10MG 10 mg

(E)-4,5-Dihydroxypent-2-enoic Acid Sodium Salt

Sign In for Pricing
View Details
Recombinant Human IL-10/Interleukin-10 Protein
PKSH031972 100 µg

Recombinant Human IL-10/Interleukin-10 Protein

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD80 Antibody[2D10]
E-AB-F1232M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD80 Antibody[2D10]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD80 Antibody[2D10]
E-AB-F1232M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD80 Antibody[2D10]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD80 Antibody[2D10]
E-AB-F1232M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD80 Antibody[2D10]

Sign In for Pricing
View Details
5-Hydroxypyrazine-2-carboxylic Acid
TRC-H952675-5G 5 g

5-Hydroxypyrazine-2-carboxylic Acid

Sign In for Pricing
View Details