Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAAR6 Rabbit Polyclonal Antibody (Biotin)

TAAR6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TA4, TAR4, TAR6, TRAR4, taR-4, taR-6

UniProt

Q96RI8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAAR6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_778237

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pdcd1lg2 shRNA (UAS) - Lentiviral mouse Pdcd1lg2 shRNA (UAS) (100)
GTR15103374 1 Vial

Lentiviral mouse Pdcd1lg2 shRNA (UAS) - Lentiviral mouse Pdcd1lg2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Probable glutamine amidotransferase SNO3 (SNO3)
MBS1132744-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Probable glutamine amidotransferase SNO3 (SNO3)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Probable glutamine amidotransferase SNO3 (SNO3)
MBS1132744-02 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Probable glutamine amidotransferase SNO3 (SNO3)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Probable glutamine amidotransferase SNO3 (SNO3)
MBS1132744-03 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Probable glutamine amidotransferase SNO3 (SNO3)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Probable glutamine amidotransferase SNO3 (SNO3)
MBS1132744-04 0.1 mg (Yeast)

Recombinant Saccharomyces cerevisiae Probable glutamine amidotransferase SNO3 (SNO3)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Probable glutamine amidotransferase SNO3 (SNO3)
MBS1132744-05 0.02 mg (Baculovirus)

Recombinant Saccharomyces cerevisiae Probable glutamine amidotransferase SNO3 (SNO3)

Sign In for Pricing
View Details