Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Erc2 Rabbit Polyclonal Antibody (Biotin)

Erc2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CA, CAST, ELKS, 6430531D06, CAST1/ERC2, D14Ertd171, ELKS2alpha, D14Ertd171e

UniProt

Q6PH08

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Erc2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TQNRMKLMADNYDEDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQLSEGL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

115kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_808482

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Cy7 Linked Monoclonal Antibody to Cluster of Differentiation 276 (CD276)
MBS2117032-01 0.1 mL

APC-Cy7 Linked Monoclonal Antibody to Cluster of Differentiation 276 (CD276)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to Cluster of Differentiation 276 (CD276)
MBS2117032-02 0.2 mL

APC-Cy7 Linked Monoclonal Antibody to Cluster of Differentiation 276 (CD276)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to Cluster of Differentiation 276 (CD276)
MBS2117032-03 0.5 mL

APC-Cy7 Linked Monoclonal Antibody to Cluster of Differentiation 276 (CD276)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to Cluster of Differentiation 276 (CD276)
MBS2117032-04 1 mL

APC-Cy7 Linked Monoclonal Antibody to Cluster of Differentiation 276 (CD276)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to Cluster of Differentiation 276 (CD276)
MBS2117032-05 5 mL

APC-Cy7 Linked Monoclonal Antibody to Cluster of Differentiation 276 (CD276)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to Cluster of Differentiation 276 (CD276)
MBS2117032-06 5x 5 mL

APC-Cy7 Linked Monoclonal Antibody to Cluster of Differentiation 276 (CD276)

Sign In for Pricing
View Details