Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPS6 Rabbit Polyclonal Antibody (HRP)

HPS6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BLOC2S3

UniProt

Q86YV9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HPS6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GARVVAVAALRGRLVWCEERQARAEGPSGSPAAAFSHCVCVRTLEPSGEA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_079023

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INHBE Antibody
OACD04803-100UL 100 µL

INHBE Antibody

Sign In for Pricing
View Details
Human B-Lymphoid Tyrosine Kinase (BLK) ELISA Kit
orb1667632-01 48 Tests

Human B-Lymphoid Tyrosine Kinase (BLK) ELISA Kit

Sign In for Pricing
View Details
Human B-Lymphoid Tyrosine Kinase (BLK) ELISA Kit
orb1667632-02 96 Tests

Human B-Lymphoid Tyrosine Kinase (BLK) ELISA Kit

Sign In for Pricing
View Details
Anti-RANTES/CCL5 Antibody Picoband® (iFluor647 Conjugate)
PB9573-iFluor647 100 µg

Anti-RANTES/CCL5 Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
P16-INK4A (ARF, CDKN2A, CDK4 Inhibitor p16 INK4, CDK4 Inhibitor p16INK4, CDK4I, CDKN2, CDKN2A, CMM2, INK4, INK4a, MLM, MTS 1, MTS1, Multiple Tumor Suppressor 1, p14, p14ARF, P16, p16 INK4, p16 INK4a, p16INK4, p16INK4a, P19, TP16) discontinued
512414 100 µg

P16-INK4A (ARF, CDKN2A, CDK4 Inhibitor p16 INK4, CDK4 Inhibitor p16INK4, CDK4I, CDKN2, CDKN2A, CMM2, INK4, INK4a, MLM, MTS 1, MTS1, Multiple Tumor Suppressor 1, p14, p14ARF, P16, p16 INK4, p16 INK4a, p16INK4, p16INK4a, P19, TP16) discontinued

Sign In for Pricing
View Details
Recombinant Mycobacterium Vanbaalenii fmt Protein (aa 1-310)
VAng-Yyj5188-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Vanbaalenii fmt Protein (aa 1-310)

Sign In for Pricing
View Details