Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITSN2 Rabbit Polyclonal Antibody (Biotin)

ITSN2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SWA, SWAP, SH3D1B, SH3P18, PRO2015

UniProt

E7EUQ1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ITSN2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDQESFGSASKSGA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

142kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_671494

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLIS2 (NM_032575) Human Recombinant Protein
PH30948E1 50 µg

GLIS2 (NM_032575) Human Recombinant Protein

Sign In for Pricing
View Details
ASPM polyclonal antibody
BS77601-01 50 µL

ASPM polyclonal antibody

Sign In for Pricing
View Details
ASPM polyclonal antibody
BS77601-02 100 µL

ASPM polyclonal antibody

Sign In for Pricing
View Details
TITF1 (NK2 Homeobox 1, BCH, BHC, NK-2, NKX2.1, NKX2A, TEBP, TITF1, TTF-1, TTF1) (MaxLight 490)
252683-ML490 100 µL

TITF1 (NK2 Homeobox 1, BCH, BHC, NK-2, NKX2.1, NKX2A, TEBP, TITF1, TTF-1, TTF1) (MaxLight 490)

Sign In for Pricing
View Details
ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2), Recombinant, Human, His-Tag, GST-Tag
055323-01 10 µg

ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2), Recombinant, Human, His-Tag, GST-Tag
055323-02 50 µg

ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details