Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIPSNAP1 Rabbit Polyclonal Antibody (HRP)

NIPSNAP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9BPW8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NIPSNAP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003625

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ornidazole Impurity 16
RM-O181416-01 10 mg

Ornidazole Impurity 16

Sign In for Pricing
View Details
Ornidazole Impurity 16
RM-O181416-02 25 mg

Ornidazole Impurity 16

Sign In for Pricing
View Details
Ornidazole Impurity 16
RM-O181416-03 50 mg

Ornidazole Impurity 16

Sign In for Pricing
View Details
Ornidazole Impurity 16
RM-O181416-04 100 mg

Ornidazole Impurity 16

Sign In for Pricing
View Details
Trim43c 3'UTR GFP Stable Cell Line
TU171110 1.0 mL

Trim43c 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-human DNA replication licensing factor MCM3 polyclonal Antibody(MCM3)
MBS1498914-01 0.05 mL

Rabbit anti-human DNA replication licensing factor MCM3 polyclonal Antibody(MCM3)

Sign In for Pricing
View Details