Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHAX Rabbit Polyclonal Antibody (HRP)

PHAX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNUXA

UniProt

Q9H814

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human PHAX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115553

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC7A7 Protein Vector (Human) (pPB-N-His)
PV039030 500 ng

SLC7A7 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
NALP2 (NACHT-, LRR- and PYD-Containing Protein 2, Nucleotide-binding Site Protein 1, PYRIN Domain and NACHT Domain-containing Protein 1, PYRIN-containing APAF1-like Protein 2, NLRP2, NBS1, PAN1, PYPAF2)
N0018-63G 100 µg

NALP2 (NACHT-, LRR- and PYD-Containing Protein 2, Nucleotide-binding Site Protein 1, PYRIN Domain and NACHT Domain-containing Protein 1, PYRIN-containing APAF1-like Protein 2, NLRP2, NBS1, PAN1, PYPAF2)

Sign In for Pricing
View Details
Bovine Galanin peptides ELISA Kit
MBS2885755-01 48 Well

Bovine Galanin peptides ELISA Kit

Sign In for Pricing
View Details
Bovine Galanin peptides ELISA Kit
MBS2885755-02 96 Well

Bovine Galanin peptides ELISA Kit

Sign In for Pricing
View Details
Bovine Galanin peptides ELISA Kit
MBS2885755-03 5x 96 Well

Bovine Galanin peptides ELISA Kit

Sign In for Pricing
View Details
Bovine Galanin peptides ELISA Kit
MBS2885755-04 10x 96 Well

Bovine Galanin peptides ELISA Kit

Sign In for Pricing
View Details