Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC14L1 Rabbit Polyclonal Antibody (Biotin)

SEC14L1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SEC14L, PRELID4A

UniProt

Q92503

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SEC14L1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLKKIAGVDYVYFVQKNSLN

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001137473

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Colony Stimulating Factor 3, Granulocyte (GCSF) ELISA Kit
orb1666200-01 48 Tests

Human Colony Stimulating Factor 3, Granulocyte (GCSF) ELISA Kit

Sign In for Pricing
View Details
Human Colony Stimulating Factor 3, Granulocyte (GCSF) ELISA Kit
orb1666200-02 96 Tests

Human Colony Stimulating Factor 3, Granulocyte (GCSF) ELISA Kit

Sign In for Pricing
View Details
UHRF2, ID (UHRF2, NIRF, RNF107, E3 ubiquitin-protein ligase UHRF2, Np95/ICBP90-like RING finger protein, Nuclear protein 97, Nuclear zinc finger protein Np97, RING finger protein 107, Ubiquitin-like PHD and RING finger domain-containing protein 2, Ubiquit
MBS6361268-01 0.2 mL

UHRF2, ID (UHRF2, NIRF, RNF107, E3 ubiquitin-protein ligase UHRF2, Np95/ICBP90-like RING finger protein, Nuclear protein 97, Nuclear zinc finger protein Np97, RING finger protein 107, Ubiquitin-like PHD and RING finger domain-containing protein 2, Ubiquit

Sign In for Pricing
View Details
UHRF2, ID (UHRF2, NIRF, RNF107, E3 ubiquitin-protein ligase UHRF2, Np95/ICBP90-like RING finger protein, Nuclear protein 97, Nuclear zinc finger protein Np97, RING finger protein 107, Ubiquitin-like PHD and RING finger domain-containing protein 2, Ubiquit
MBS6361268-02 5x 0.2 mL

UHRF2, ID (UHRF2, NIRF, RNF107, E3 ubiquitin-protein ligase UHRF2, Np95/ICBP90-like RING finger protein, Nuclear protein 97, Nuclear zinc finger protein Np97, RING finger protein 107, Ubiquitin-like PHD and RING finger domain-containing protein 2, Ubiquit

Sign In for Pricing
View Details
A2ld1 ORF Vector (Mouse) (pORF)
ORF037652 1.0 µg DNA

A2ld1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Anti-Anopheles gambiae (African malaria mosquito) AgCASPAR Antibody PE Conjugated
DZ41845-PE 200 µL/Vial

Anti-Anopheles gambiae (African malaria mosquito) AgCASPAR Antibody PE Conjugated

Sign In for Pricing
View Details