Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK19 Rabbit Polyclonal Antibody (HRP)

STK19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G11, RP1, D6S60, D6S60E, HLA-RP1

UniProt

P49842

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human STK19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_115830

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHL2 Human qPCR Primer Pair (NM_001450)
HP229007 200 Reactions

FHL2 Human qPCR Primer Pair (NM_001450)

Sign In for Pricing
View Details
HRP Conjugated CCR7 Recombinant Rabbit Monoclonal Antibody [SR36-04]
HA721185 100 µL

HRP Conjugated CCR7 Recombinant Rabbit Monoclonal Antibody [SR36-04]

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (AIF1/2493), CF594 conjugate, 0.1mg/mL
BNC942493-500 1x 500 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/2493), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KDM1A Antibody
KC-2783-01 50 μL

KDM1A Antibody

Sign In for Pricing
View Details
KDM1A Antibody
KC-2783-02 100 µL

KDM1A Antibody

Sign In for Pricing
View Details
KDM1A Antibody
KC-2783-03 1 mL

KDM1A Antibody

Sign In for Pricing
View Details