Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CH25H Rabbit Polyclonal Antibody (HRP)

CH25H Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C25H

UniProt

O95992

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CH25H

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human BCL2 protein, GST-tagged
BCL2-26734TH 20 µg

Recombinant Human BCL2 protein, GST-tagged

Sign In for Pricing
View Details
MACS1 siRNA (h)
sc-93228 10 µM

MACS1 siRNA (h)

Sign In for Pricing
View Details
Chicken Basic Leucine Zipper and W2 Domain-Containing Protein 2 (BZW2) ELISA Kit
MBS9933144 Inquire

Chicken Basic Leucine Zipper and W2 Domain-Containing Protein 2 (BZW2) ELISA Kit

Sign In for Pricing
View Details
Cyclophilin G (Peptidyl-prolyl Cis-trans Isomerase G, Peptidyl-prolyl Isomerase G, PPIase G, Rotamase G, PPIG, Clk-associating RS-cyclophilin, CARS-cyclophilin, CARS-Cyp, SR-cyclophilin, SR-cyp, SRcyp, CASP10, PPIG) (MaxLight 490)
125548-ML490 100 µL

Cyclophilin G (Peptidyl-prolyl Cis-trans Isomerase G, Peptidyl-prolyl Isomerase G, PPIase G, Rotamase G, PPIG, Clk-associating RS-cyclophilin, CARS-cyclophilin, CARS-Cyp, SR-cyclophilin, SR-cyp, SRcyp, CASP10, PPIG) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Souble Inducible T-Cell Costimulator ELISA Kit
MBS748872-01 48 Well

Rabbit Souble Inducible T-Cell Costimulator ELISA Kit

Sign In for Pricing
View Details
Rabbit Souble Inducible T-Cell Costimulator ELISA Kit
MBS748872-02 96 Well

Rabbit Souble Inducible T-Cell Costimulator ELISA Kit

Sign In for Pricing
View Details