Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enpep Rabbit Polyclonal Antibody (Biotin)

Enpep Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

APA, Ly5, Ly-5, Ly51, Ly-51, Bp-1/6C, Bp-1/6C3, 6030431M22Rik

UniProt

P16406

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Enpep

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NTELQLWQMQSFFAKYPNAGAGAKPREQVLETVKNNIEWLNVNRQSIREW

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031960

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENAH / MENA (Actin Regulator) (ENAH/1988), CF488A conjugate, 0.1mg/mL
BNC881988-500 1x 500 µL

ENAH / MENA (Actin Regulator) (ENAH/1988), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human AIMP1 (Aminoacyl tRNA Synthetase Complex Interacting Multifunctional Protein 1) CLIA Kit
E-CL-H0186-01 24 Tests

Human AIMP1 (Aminoacyl tRNA Synthetase Complex Interacting Multifunctional Protein 1) CLIA Kit

Sign In for Pricing
View Details
Human AIMP1 (Aminoacyl tRNA Synthetase Complex Interacting Multifunctional Protein 1) CLIA Kit
E-CL-H0186-02 48 Tests

Human AIMP1 (Aminoacyl tRNA Synthetase Complex Interacting Multifunctional Protein 1) CLIA Kit

Sign In for Pricing
View Details
Human AIMP1 (Aminoacyl tRNA Synthetase Complex Interacting Multifunctional Protein 1) CLIA Kit
E-CL-H0186-03 96 Tests

Human AIMP1 (Aminoacyl tRNA Synthetase Complex Interacting Multifunctional Protein 1) CLIA Kit

Sign In for Pricing
View Details
Goat anti-Rabbit IgG Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS
MT26F4-aR/W 10x 96 Well Plates

Goat anti-Rabbit IgG Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS

Sign In for Pricing
View Details
LOX Antibody
F53728-0.1ML 0.1 mL

LOX Antibody

Sign In for Pricing
View Details