Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enpep Rabbit Polyclonal Antibody (HRP)

Enpep Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

APA, Ly5, Ly-5, Ly51, Ly-51, Bp-1/6C, Bp-1/6C3, 6030431M22Rik

UniProt

P16406

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Enpep

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NTELQLWQMQSFFAKYPNAGAGAKPREQVLETVKNNIEWLNVNRQSIREW

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031960

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAGE12F Protein Lysate (Human) with C-Ha Tag
21185031 100 µg

GAGE12F Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Mouse Monoclonal Ornithine Decarboxylase Antibody (OTI1G6) [Alexa Fluor 700]
NBP2-73150AF700 0.1 mL

Mouse Monoclonal Ornithine Decarboxylase Antibody (OTI1G6) [Alexa Fluor 700]

Sign In for Pricing
View Details
Human Uncharacterized protein KIAA1211, KIAA1211 ELISA KIT
ELI-39679h 96 Tests

Human Uncharacterized protein KIAA1211, KIAA1211 ELISA KIT

Sign In for Pricing
View Details
CXCL2 Antibody
R34493-100UG 100 µg

CXCL2 Antibody

Sign In for Pricing
View Details
ATG5 Rabbit Polyclonal Antibody
TA383770 100 µL

ATG5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Canine 80kDa MCM3-Associated Protein (MCM3AP) ELISA Kit
MBS9392854-01 48 Well

Canine 80kDa MCM3-Associated Protein (MCM3AP) ELISA Kit

Sign In for Pricing
View Details