Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENPEP Rabbit Polyclonal Antibody (HRP)

ENPEP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

APA, CD249, gp160

UniProt

Q07075

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ENPEP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLI

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

109kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001968

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fatty acid-binding protein antibody *Mouse anti-human, monoclonal IgG1*
V100105-AAT 50 µg

Anti-Fatty acid-binding protein antibody *Mouse anti-human, monoclonal IgG1*

Sign In for Pricing
View Details
Zinc Iodide
TRC-Z439675-5G 5 g

Zinc Iodide

Sign In for Pricing
View Details
Santacruzamate A
SIH-613-5MG 5 mg

Santacruzamate A

Sign In for Pricing
View Details
Forced Convection Oven BOFC-5501
BOFC-5501 1 Unit

Forced Convection Oven BOFC-5501

Sign In for Pricing
View Details
Recombinant Dopamine Receptor D1 Antibody
RC-15557-01 50 μL

Recombinant Dopamine Receptor D1 Antibody

Sign In for Pricing
View Details
Recombinant Dopamine Receptor D1 Antibody
RC-15557-02 100 µL

Recombinant Dopamine Receptor D1 Antibody

Sign In for Pricing
View Details