Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENPEP Rabbit Polyclonal Antibody (HRP)

ENPEP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

APA, CD249, gp160

UniProt

Q07075

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ENPEP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLI

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

109kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001968

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/2208R), CF740 conjugate, 0.1mg/mL
BNC742208-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/2208R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(R)-1-Phenethyl Alcohol
TRC-P296005-25G 25 g

(R)-1-Phenethyl Alcohol

Sign In for Pricing
View Details
H2AZ2 (NM_012412) Human Over-expression Lysate
LC402207 20 µg

H2AZ2 (NM_012412) Human Over-expression Lysate

Sign In for Pricing
View Details
CCDC53 (WASHC3) (NM_001301107) Human Tagged ORF Clone
RG236464 10 µg

CCDC53 (WASHC3) (NM_001301107) Human Tagged ORF Clone

Sign In for Pricing
View Details
CAV1 Polyclonal Antibody
E-AB-30778-01 20 µL

CAV1 Polyclonal Antibody

Sign In for Pricing
View Details
CAV1 Polyclonal Antibody
E-AB-30778-02 60 µL

CAV1 Polyclonal Antibody

Sign In for Pricing
View Details