Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL22RA2 Rabbit Polyclonal Antibody (Biotin)

IL22RA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CRF2X, CRF2-10, CRF2-S1, IL-22BP, IL-22RA2, ZCYTOR16, IL-22R-alpha-2

UniProt

Q969J5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL22RA2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_443194

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Ovarian Cancer Marker/Carbohydrate Antigen 125 ELISA Kit
MBS035323-01 48 Well

Canine Ovarian Cancer Marker/Carbohydrate Antigen 125 ELISA Kit

Sign In for Pricing
View Details
Canine Ovarian Cancer Marker/Carbohydrate Antigen 125 ELISA Kit
MBS035323-02 96 Well

Canine Ovarian Cancer Marker/Carbohydrate Antigen 125 ELISA Kit

Sign In for Pricing
View Details
Canine Ovarian Cancer Marker/Carbohydrate Antigen 125 ELISA Kit
MBS035323-03 5x 96 Well

Canine Ovarian Cancer Marker/Carbohydrate Antigen 125 ELISA Kit

Sign In for Pricing
View Details
Canine Ovarian Cancer Marker/Carbohydrate Antigen 125 ELISA Kit
MBS035323-04 10x 96 Well

Canine Ovarian Cancer Marker/Carbohydrate Antigen 125 ELISA Kit

Sign In for Pricing
View Details
ZHX2 Rabbit mAb Antibody
orb3015953 100 µL

ZHX2 Rabbit mAb Antibody

Sign In for Pricing
View Details
FOXO1, Phosphorylated (Thr24) (FKHR, Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FOXO1A) (AP)
MBS6269583-01 0.1 mL

FOXO1, Phosphorylated (Thr24) (FKHR, Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FOXO1A) (AP)

Sign In for Pricing
View Details