Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL22RA2 Rabbit Polyclonal Antibody (HRP)

IL22RA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CRF2X, CRF2-10, CRF2-S1, IL-22BP, IL-22RA2, ZCYTOR16, IL-22R-alpha-2

UniProt

Q969J5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL22RA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_443194

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CCDC43 Antibody [Alexa Fluor 532]
NB100-97844AF532 0.1 mL

Rabbit Polyclonal CCDC43 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Borrelia burgdorferi, Outer Surface Protein B p19 (Lyme Disease) (Biotin)
MBS6248437-01 0.1 mL

Borrelia burgdorferi, Outer Surface Protein B p19 (Lyme Disease) (Biotin)

Sign In for Pricing
View Details
Borrelia burgdorferi, Outer Surface Protein B p19 (Lyme Disease) (Biotin)
MBS6248437-02 5x 0.1 mL

Borrelia burgdorferi, Outer Surface Protein B p19 (Lyme Disease) (Biotin)

Sign In for Pricing
View Details
Remodelin Fluor
MBS3602787 Inquire

Remodelin Fluor

Sign In for Pricing
View Details
Tripolin A
2307-5 5 mg

Tripolin A

Sign In for Pricing
View Details
Lentiviral human ATP5PB sgRNA gene knockout kit - Lentiviral human ATP5PB sgRNA gene knockout kit (25)
GTR15401172 1 Vial

Lentiviral human ATP5PB sgRNA gene knockout kit - Lentiviral human ATP5PB sgRNA gene knockout kit (25)

Sign In for Pricing
View Details