Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCUBE1 Rabbit Polyclonal Antibody (Biotin)

SCUBE1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q86TI6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SCUBE1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PGYKGEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766638

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General Transcription Factor IIH, Polypeptide 4, 52kD (General Transcription Factor IIH Subunit 4, GTF2H4, Basic Transcription Factor 2 52kD Subunit, BTF2 p52, TFB2, TFIIH Basal Transcription Factor Complex p52 Subunit, TFIIH) (PE)
MBS6477700-01 0.2 mL

General Transcription Factor IIH, Polypeptide 4, 52kD (General Transcription Factor IIH Subunit 4, GTF2H4, Basic Transcription Factor 2 52kD Subunit, BTF2 p52, TFB2, TFIIH Basal Transcription Factor Complex p52 Subunit, TFIIH) (PE)

Sign In for Pricing
View Details
General Transcription Factor IIH, Polypeptide 4, 52kD (General Transcription Factor IIH Subunit 4, GTF2H4, Basic Transcription Factor 2 52kD Subunit, BTF2 p52, TFB2, TFIIH Basal Transcription Factor Complex p52 Subunit, TFIIH) (PE)
MBS6477700-02 5x 0.2 mL

General Transcription Factor IIH, Polypeptide 4, 52kD (General Transcription Factor IIH Subunit 4, GTF2H4, Basic Transcription Factor 2 52kD Subunit, BTF2 p52, TFB2, TFIIH Basal Transcription Factor Complex p52 Subunit, TFIIH) (PE)

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 6Q1 (OR6Q1)
MBS7025077-01 0.02 mg

Recombinant Human Olfactory receptor 6Q1 (OR6Q1)

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 6Q1 (OR6Q1)
MBS7025077-02 0.1 mg

Recombinant Human Olfactory receptor 6Q1 (OR6Q1)

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 6Q1 (OR6Q1)
MBS7025077-03 5x 0.1 mg

Recombinant Human Olfactory receptor 6Q1 (OR6Q1)

Sign In for Pricing
View Details
CIKS, CT (Connection to IKK and SAPK, JNK, Act1, NF-kB Activator 1) (HRP) discontinued
C5072-75A-HRP 100 µL

CIKS, CT (Connection to IKK and SAPK, JNK, Act1, NF-kB Activator 1) (HRP) discontinued

Sign In for Pricing
View Details