Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCUBE1 Rabbit Polyclonal Antibody (FITC)

SCUBE1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q86TI6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SCUBE1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGYKGEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766638

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Magnetic Fluorescence Assay Kit
MBS2161216-01 96 Tests

Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Magnetic Fluorescence Assay Kit
MBS2161216-02 5x 96 Tests

Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Magnetic Fluorescence Assay Kit
MBS2161216-03 10x 96 Tests

Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
FLVCR1 Protein Vector (Human) (pPB-N-His)
PV016478 500 ng

FLVCR1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
DTS LCD Series Dual Frequency Ultrasonic Cleaner
E1787 1 Unit

DTS LCD Series Dual Frequency Ultrasonic Cleaner

Sign In for Pricing
View Details
DDX24, ID (DDX24, ATP-dependent RNA helicase DDX24, DEAD box protein 24) (PE) discontinued
034550-PE 200 µL

DDX24, ID (DDX24, ATP-dependent RNA helicase DDX24, DEAD box protein 24) (PE) discontinued

Sign In for Pricing
View Details