Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCUBE1 Rabbit Polyclonal Antibody (HRP)

SCUBE1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q86TI6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SCUBE1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGYKGEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766638

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA19 Antibody
orb1238198-01 0.02 mg

SPATA19 Antibody

Sign In for Pricing
View Details
SPATA19 Antibody
orb1238198-02 0.1 mg

SPATA19 Antibody

Sign In for Pricing
View Details
KRT6B (Keratin 6B, CK6B, K6B, KRTL1, PC2) (APC)
MBS6169773-01 0.1 mL

KRT6B (Keratin 6B, CK6B, K6B, KRTL1, PC2) (APC)

Sign In for Pricing
View Details
KRT6B (Keratin 6B, CK6B, K6B, KRTL1, PC2) (APC)
MBS6169773-02 5x 0.1 mL

KRT6B (Keratin 6B, CK6B, K6B, KRTL1, PC2) (APC)

Sign In for Pricing
View Details
Lentiviral human NPAS3 shRNA (UAS) - Lentiviral human NPAS3 shRNA (UAS, GFP) plasmid
GTR15101530 1 Vial

Lentiviral human NPAS3 shRNA (UAS) - Lentiviral human NPAS3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
UCP3 CRISPR/Cas9 KO Plasmid (m2)
sc-423597-KO-2 20 µg

UCP3 CRISPR/Cas9 KO Plasmid (m2)

Sign In for Pricing
View Details