Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMM23B Rabbit Polyclonal Antibody (FITC)

TIMM23B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BA592B15.7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TIMM23B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

CAI16098

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF665 sgRNA CRISPR Lentivector set (Human)
K2723601 3x 1.0 µg

ZNF665 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Caveolin-1 (phospho Tyr14) Rabbit Polyclonal Antibody
APRab04389-01 20 µL

Caveolin-1 (phospho Tyr14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caveolin-1 (phospho Tyr14) Rabbit Polyclonal Antibody
APRab04389-02 50 µL

Caveolin-1 (phospho Tyr14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caveolin-1 (phospho Tyr14) Rabbit Polyclonal Antibody
APRab04389-03 100 µL

Caveolin-1 (phospho Tyr14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caveolin-1 (phospho Tyr14) Rabbit Polyclonal Antibody
APRab04389-04 200 µL

Caveolin-1 (phospho Tyr14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Intelectin-1/Omentin Antibody (ITLN1/4066)
NBP3-07691-20ug 20 µg

Mouse Monoclonal Intelectin-1/Omentin Antibody (ITLN1/4066)

Sign In for Pricing
View Details