Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMM23B Rabbit Polyclonal Antibody (HRP)

TIMM23B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BA592B15.7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TIMM23B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

CAI16098

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICOS Ligand (ICOSLG) Mouse Monoclonal Antibody [Clone ID: OTI1D10]
CF808595 100 µg

ICOS Ligand (ICOSLG) Mouse Monoclonal Antibody [Clone ID: OTI1D10]

Sign In for Pricing
View Details
SIRT7 (C-term) Rabbit Polyclonal Antibody
AP13220PU-N 400 µL

SIRT7 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
-86°C ULT Freezer Chest BFRZ-86-201
BFRZ-86-201 1 Unit

-86°C ULT Freezer Chest BFRZ-86-201

Sign In for Pricing
View Details
DHRS7 Rabbit Polyclonal Antibody
TA365796 100 µL

DHRS7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Axin 1 (AXIN1) (NM_181050) Human Recombinant Protein
TP308349L 1 mg

Axin 1 (AXIN1) (NM_181050) Human Recombinant Protein

Sign In for Pricing
View Details
Factor X (F10) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A9]
TA811724AM 100 µL

Factor X (F10) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A9]

Sign In for Pricing
View Details