Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNPO3 Rabbit Polyclonal Antibody (Biotin)

TNPO3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C81142, Trn-SR, D6Ertd313, mKIAA4133, D6Ertd313e, 5730544L10Rik, C430013M08Rik

UniProt

Q6P2B1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse TNPO3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QWAIASTTLDHRDANSSVMRFLRDLIHTGVANDHEEDFELRKELIGQVMS

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

101 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCAAT/enhancer binding protein beta, C/EBP beta ELISA Kit
SL2367Hu-01 48 Tests

Human CCAAT/enhancer binding protein beta, C/EBP beta ELISA Kit

Sign In for Pricing
View Details
Human CCAAT/enhancer binding protein beta, C/EBP beta ELISA Kit
SL2367Hu-02 96 Tests

Human CCAAT/enhancer binding protein beta, C/EBP beta ELISA Kit

Sign In for Pricing
View Details
Olr1750 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
34185116 3x 1.0 µg

Olr1750 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
RAB4A sgRNA CRISPR Lentivector (Human) (Target 3)
K1769204 1.0 µg DNA

RAB4A sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
REXO1 Antibody
MBS8583945-01 0.1 mL

REXO1 Antibody

Sign In for Pricing
View Details
REXO1 Antibody
MBS8583945-02 0.1 mL (AF635)

REXO1 Antibody

Sign In for Pricing
View Details