Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNPO3 Rabbit Polyclonal Antibody (HRP)

TNPO3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C81142, Trn-SR, D6Ertd313, mKIAA4133, D6Ertd313e, 5730544L10Rik, C430013M08Rik

UniProt

Q6P2B1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse TNPO3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QWAIASTTLDHRDANSSVMRFLRDLIHTGVANDHEEDFELRKELIGQVMS

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

101 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HtrA3 Antibody [CoraFluor 1]
NBP2-99121CL1 0.1 mL

Rabbit Polyclonal HtrA3 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Atp6v1g1 (NM_001106660) Rat Tagged ORF Clone Lentiviral Particle
RR212357L4V 200 µL

Atp6v1g1 (NM_001106660) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Atp1b2 Antibody
GWB-MQ037A 50 µg

Atp1b2 Antibody

Sign In for Pricing
View Details
Recombinant Human EIF4E Protein, N-His
YHC20901 100 μg

Recombinant Human EIF4E Protein, N-His

Sign In for Pricing
View Details
p53 (Acetyl Lys370) Polyclonal Antibody
UB-GEN-44 100 µL

p53 (Acetyl Lys370) Polyclonal Antibody

Sign In for Pricing
View Details
DUOXA1 (Dual Oxidase Maturation Factor 1, Dual Oxidase Activator 1, Numb-interacting Protein, NIP, NUMBIP, FLJ32334)
MBS6004574-01 0.05 mg

DUOXA1 (Dual Oxidase Maturation Factor 1, Dual Oxidase Activator 1, Numb-interacting Protein, NIP, NUMBIP, FLJ32334)

Sign In for Pricing
View Details