Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNA2D4 Rabbit Polyclonal Antibody (FITC)

CACNA2D4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RCD4

UniProt

Q7Z3S7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CACNA2D4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ADLNHEFNESLVFDYYNSVLINERDEKGNFVELGAEFLLESNAHFSNLPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_758952.4

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Transcriptional activator protein Pur-alpha, PURA ELISA Kit
MBS9323124-01 48 Well

Rat Transcriptional activator protein Pur-alpha, PURA ELISA Kit

Sign In for Pricing
View Details
Rat Transcriptional activator protein Pur-alpha, PURA ELISA Kit
MBS9323124-02 96 Well

Rat Transcriptional activator protein Pur-alpha, PURA ELISA Kit

Sign In for Pricing
View Details
Rat Transcriptional activator protein Pur-alpha, PURA ELISA Kit
MBS9323124-03 5x 96 Well

Rat Transcriptional activator protein Pur-alpha, PURA ELISA Kit

Sign In for Pricing
View Details
Rat Transcriptional activator protein Pur-alpha, PURA ELISA Kit
MBS9323124-04 10x 96 Well

Rat Transcriptional activator protein Pur-alpha, PURA ELISA Kit

Sign In for Pricing
View Details
Chorionic Gonadotrophin β (β-CG) Monkey ELISA Kit
C3127 96 Tests

Chorionic Gonadotrophin β (β-CG) Monkey ELISA Kit

Sign In for Pricing
View Details
Recombinant Sinorhizobium medicae Probable intracellular septation protein A (Smed_3090)
orb2912533-01 20 µg

Recombinant Sinorhizobium medicae Probable intracellular septation protein A (Smed_3090)

Sign In for Pricing
View Details