Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIAPH3 Rabbit Polyclonal Antibody (HRP)

DIAPH3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AN, DIA2, DRF3, AUNA1, NSDAN, diap3, mDia2

UniProt

Q9NSV4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DIAPH3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVTSP

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

122kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhesus monkey Interleukin 8 (IL8) Antibody Pair Kit (with Standard)
MBS2089685-01 5x 96 Tests

Rhesus monkey Interleukin 8 (IL8) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rhesus monkey Interleukin 8 (IL8) Antibody Pair Kit (with Standard)
MBS2089685-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rhesus monkey Interleukin 8 (IL8) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rhesus monkey Interleukin 8 (IL8) Antibody Pair Kit (with Standard)
MBS2089685-03 10x 96 Tests

Rhesus monkey Interleukin 8 (IL8) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rhesus monkey Interleukin 8 (IL8) Antibody Pair Kit (with Standard)
MBS2089685-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rhesus monkey Interleukin 8 (IL8) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
EphA2 Biosimilar (Sanofi Aventis patent EphA2 Reference Antibody)
orb2703677-01 1 mg

EphA2 Biosimilar (Sanofi Aventis patent EphA2 Reference Antibody)

Sign In for Pricing
View Details
EphA2 Biosimilar (Sanofi Aventis patent EphA2 Reference Antibody)
orb2703677-02 5 mg

EphA2 Biosimilar (Sanofi Aventis patent EphA2 Reference Antibody)

Sign In for Pricing
View Details