Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP14 Rabbit Polyclonal Antibody (HRP)

DUSP14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MKP6, MKP-L

UniProt

O95147

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DUSP14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_008957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bbip1 3'UTR GFP Stable Cell Line
TU152543 1.0 mL

Bbip1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tight Junction Associated Protein 1, Peripheral (TJAP1), Recombinant, Human, His-Tag
050551-01 10 µg

Tight Junction Associated Protein 1, Peripheral (TJAP1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Tight Junction Associated Protein 1, Peripheral (TJAP1), Recombinant, Human, His-Tag
050551-02 50 µg

Tight Junction Associated Protein 1, Peripheral (TJAP1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Tight Junction Associated Protein 1, Peripheral (TJAP1), Recombinant, Human, His-Tag
050551-03 100 µg

Tight Junction Associated Protein 1, Peripheral (TJAP1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Tight Junction Associated Protein 1, Peripheral (TJAP1), Recombinant, Human, His-Tag
050551-04 200 µg

Tight Junction Associated Protein 1, Peripheral (TJAP1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Rat Cyp11b3 ELISA Kit
ELI-49308r 96 Tests

Rat Cyp11b3 ELISA Kit

Sign In for Pricing
View Details